Lineage for d1ja1b2 (1ja1 B:65-239)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120383Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 120462Family c.23.5.2: NADPH-cytochrome p450 reductase, N-terminal domain [52231] (1 protein)
  6. 120463Protein NADPH-cytochrome p450 reductase, N-terminal domain [52232] (2 species)
  7. 120466Species Rat (Rattus norvegicus) [TaxId:10116] [52233] (4 PDB entries)
  8. 120468Domain d1ja1b2: 1ja1 B:65-239 [62807]
    Other proteins in same PDB: d1ja1a1, d1ja1a3, d1ja1b1, d1ja1b3

Details for d1ja1b2

PDB Entry: 1ja1 (more details), 1.8 Å

PDB Description: cypor-triple mutant

SCOP Domain Sequences for d1ja1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ja1b2 c.23.5.2 (B:65-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus)}
kessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlss
lpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnam
gkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatgee

SCOP Domain Coordinates for d1ja1b2:

Click to download the PDB-style file with coordinates for d1ja1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ja1b2: