SCOP 1.59: Domain d1j7vr1: 1j7v R:2-100

Lineage for d1j7vr1 (1j7v R:2-100)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63671] (1 PDB entry)

8. Domain d1j7vr1: 1j7v R:2-100 [62705]
   Other proteins in same PDB: d1j7vl_

Details for d1j7vr1

PDB Entry: 1j7v, 2.9 Å

PDB Description: human il-10 / il-10r1 complex

SCOP Domain Sequences for d1j7vr1:

Sequence; same for both SEQRES and ATOM records:

>d1j7vr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens)}
gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvd

Timeline for d1j7vr1:

• d1j7vr1 first appeared in SCOP 1.57
  
• d1j7vr1 appears in SCOP 1.61
  
• d1j7vr1 appears in the current release, SCOPe 2.08