Class g: Small proteins [56992] (94 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein Insulin [56996] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56998] (61 PDB entries) Uniprot P01308 |
Domain d1j73.2: 1j73 D:,C: [62671] an unstable insulin analog with native activity complexed with zn |
PDB Entry: 1j73 (more details), 2 Å
SCOPe Domain Sequences for d1j73.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1j73.2 g.1.1.1 (D:,C:) Insulin {Human (Homo sapiens) [TaxId: 9606]} fvnqhlcgshlvealylvcgergffytpktXgiveqccasicslyqlenycn
Timeline for d1j73.2:
View in 3D Domains from other chains: (mouse over for more information) d1j73.1, d1j73.1, d1j73.1, d1j73.1 |