| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein Actin [53073] (7 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (62 PDB entries) Uniprot P02568 ! SQ 02568 |
| Domain d1j6za1: 1j6z A:4-146 [62667] complexed with adp, ca, rho |
PDB Entry: 1j6z (more details), 1.54 Å
SCOPe Domain Sequences for d1j6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j6za1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg
Timeline for d1j6za1: