Lineage for d1j6za1 (1j6z A:4-146)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) 
Family c.55.1.1: Actin/HSP70 [53068] (4 proteins) Protein Actin [53073] (5 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (5 PDB entries) 
Domain d1j6za1: 1j6z A:4-146 [62667]
Details for d1j6za1
PDB Entry: 1j6z (more details), 1.54 Å
PDB Description: uncomplexed actin
SCOP Domain Sequences for d1j6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j6za1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus)}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg
SCOP Domain Coordinates for d1j6za1:
Click to download the PDB-style file with coordinates for d1j6za1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j6za1:
- d1j6za1 is new in SCOP 1.57
- d1j6za1 appears in SCOP 1.59
- d1j6za1 appears in the current release, SCOPe 2.08
View in 3D
