Lineage for d1j6za1 (1j6z A:4-146)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 835947Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 835948Protein Actin [53073] (6 species)
  7. 836046Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries)
    Uniprot P02568
    SQ 02568
    Uniprot P02568 ! SQ 02568
  8. 836051Domain d1j6za1: 1j6z A:4-146 [62667]

Details for d1j6za1

PDB Entry: 1j6z (more details), 1.54 Å

PDB Description: uncomplexed actin
PDB Compounds: (A:) actin alpha 1

SCOP Domain Sequences for d1j6za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6za1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

SCOP Domain Coordinates for d1j6za1:

Click to download the PDB-style file with coordinates for d1j6za1.
(The format of our PDB-style files is described here.)

Timeline for d1j6za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j6za2