SCOP 1.75: Domain d1j6za1: 1j6z A:4-146

Lineage for d1j6za1 (1j6z A:4-146)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries)
   Uniprot P02568
   SQ 02568
   Uniprot P02568 ! SQ 02568

8. Domain d1j6za1: 1j6z A:4-146 [62667]

Details for d1j6za1

PDB Entry: 1j6z, 1.54 Å

PDB Description: uncomplexed actin

PDB Compounds: (A:) actin alpha 1

SCOP Domain Sequences for d1j6za1:

Sequence; same for both SEQRES and ATOM records:

>d1j6za1 c.55.1.1 (A:4-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

Timeline for d1j6za1:

• d1j6za1 first appeared in SCOP 1.57
  
• d1j6za1 appears in SCOP 1.73
  
• d1j6za1 appears in SCOPe 2.01
  
• d1j6za1 appears in the current release, SCOPe 2.08