Lineage for d1j6xa_ (1j6x A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139995Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 139996Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 140106Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
  6. 140107Protein Autoinducer-2 production protein LuxS [64295] (4 species)
  7. 140124Species Helicobacter pylori [TaxId:210] [64299] (1 PDB entry)
  8. 140125Domain d1j6xa_: 1j6x A: [62665]

Details for d1j6xa_

PDB Entry: 1j6x (more details), 2.38 Å

PDB Description: crystal structure of helicobacter pylori luxs

SCOP Domain Sequences for d1j6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6xa_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Helicobacter pylori}
mkmnvesfnldhtkvkapyvriadrkkgvngdlivkydvrfkqpnrdhmdmpslhslehl
vaeiirnhanyvvdwspmgcqtgfyltvlnhdnyteilevlektmqdvlkakevpasnek
qcgwaanhtlegaqnlarafldkraewsevg

SCOP Domain Coordinates for d1j6xa_:

Click to download the PDB-style file with coordinates for d1j6xa_.
(The format of our PDB-style files is described here.)

Timeline for d1j6xa_: