Lineage for d1j6va_ (1j6v A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049845Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1049846Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1050080Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
  6. 1050081Protein Autoinducer-2 production protein LuxS [64295] (4 species)
    S-ribosylhomocysteinase
  7. 1050090Species Deinococcus radiodurans [TaxId:1299] [64297] (5 PDB entries)
  8. 1050098Domain d1j6va_: 1j6v A: [62662]
    complexed with zn

Details for d1j6va_

PDB Entry: 1j6v (more details), 2.1 Å

PDB Description: crystal structure of d. radiodurans luxs, c2
PDB Compounds: (A:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1j6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6va_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans [TaxId: 1299]}
vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
nyrdhdlaaarqhardvldqglkvqetille

SCOPe Domain Coordinates for d1j6va_:

Click to download the PDB-style file with coordinates for d1j6va_.
(The format of our PDB-style files is described here.)

Timeline for d1j6va_: