Lineage for d1iqpb2 (1iqp B:2-232)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 485481Family c.37.1.20: Extended AAA-ATPase domain [81269] (25 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 485650Protein Replication factor C [64035] (1 species)
    contains additional alpha-helical domain after the family specific domains
  7. 485651Species Archaeon Pyrococcus furiosus [TaxId:2261] [64036] (1 PDB entry)
  8. 485653Domain d1iqpb2: 1iqp B:2-232 [62652]
    Other proteins in same PDB: d1iqpa1, d1iqpb1, d1iqpc1, d1iqpd1, d1iqpe1, d1iqpf1

Details for d1iqpb2

PDB Entry: 1iqp (more details), 2.8 Å

PDB Description: Crystal Structure of the Clamp Loader Small Subunit from Pyrococcus furiosus

SCOP Domain Sequences for d1iqpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqpb2 c.37.1.20 (B:2-232) Replication factor C {Archaeon Pyrococcus furiosus}
seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt
aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada
ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi
aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvas

SCOP Domain Coordinates for d1iqpb2:

Click to download the PDB-style file with coordinates for d1iqpb2.
(The format of our PDB-style files is described here.)

Timeline for d1iqpb2: