SCOP 1.69: Domain d1iqpa1: 1iqp A:233-327

Lineage for d1iqpa1 (1iqp A:233-327)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein Replication factor C [63582] (1 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [63583] (1 PDB entry)

8. Domain d1iqpa1: 1iqp A:233-327 [62649]
   Other proteins in same PDB: d1iqpa2, d1iqpb2, d1iqpc2, d1iqpd2, d1iqpe2, d1iqpf2

Details for d1iqpa1

PDB Entry: 1iqp, 2.8 Å

PDB Description: Crystal Structure of the Clamp Loader Small Subunit from Pyrococcus furiosus

SCOP Domain Sequences for d1iqpa1:

Sequence; same for both SEQRES and ATOM records:

>d1iqpa1 a.80.1.1 (A:233-327) Replication factor C {Archaeon Pyrococcus furiosus}
rarpediremmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvl
ladkigeynfrlveganeiiqleallaqftligkk

Timeline for d1iqpa1:

• d1iqpa1 first appeared in SCOP 1.57
  
• d1iqpa1 appears in SCOP 1.67
  
• d1iqpa1 appears in SCOP 1.71
  
• d1iqpa1 appears in the current release, SCOPe 2.08