SCOPe 2.07: Domain d1ip9a1: 1ip9 A:6-85

Lineage for d1ip9a1 (1ip9 A:6-85)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (11 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Bud emergence mediator Bemp1 [64226] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64227] (2 PDB entries)

8. Domain d1ip9a1: 1ip9 A:6-85 [62638]
   Other proteins in same PDB: d1ip9a2

Details for d1ip9a1

PDB Entry: 1ip9

PDB Description: solution structure of the pb1 domain of bem1p

PDB Compounds: (A:) bem1 protein

SCOPe Domain Sequences for d1ip9a1:

Sequence; same for both SEQRES and ATOM records:

>d1ip9a1 d.15.2.2 (A:6-85) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stsglkttkikfyykddifalmlkgdttykelrskiapridtdnfklqtklfdgsgeeik
tdsqvsniiqaklkisvhdi

Timeline for d1ip9a1:

• d1ip9a1 first appeared in SCOP 1.57, called d1ip9a_
  
• d1ip9a1 appears in SCOPe 2.06
  
• d1ip9a1 appears in the current release, SCOPe 2.08