Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) |
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein) |
Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [64099] (2 PDB entries) |
Domain d1iofa_: 1iof A: [62625] |
PDB Entry: 1iof (more details), 2.2 Å
SCOP Domain Sequences for d1iofa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iofa_ c.56.4.1 (A:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus furiosus} mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki mkklhergipayisnsaglylcnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk gqvppsmcyemeleavkvaievaleell
Timeline for d1iofa_: