SCOP 1.59: Domain d1iofa_: 1iof A:

Lineage for d1iofa_ (1iof A:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)

4. Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family)

5. Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein)

6. Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (3 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [64099] (2 PDB entries)

8. Domain d1iofa_: 1iof A: [62625]

Details for d1iofa_

PDB Entry: 1iof, 2.2 Å

PDB Description: x-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant

SCOP Domain Sequences for d1iofa_:

Sequence; same for both SEQRES and ATOM records:

>d1iofa_ c.56.4.1 (A:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus furiosus}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylcnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmcyemeleavkvaievaleell

Timeline for d1iofa_:

• d1iofa_ first appeared in SCOP 1.57
  
• d1iofa_ appears in SCOP 1.61
  
• d1iofa_ appears in the current release, SCOPe 2.08