SCOP 1.57: Domain d1ioda_: 1iod A:

Lineage for d1ioda_ (1iod A:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (5 families)

5. Family d.169.1.1: C-type lectin domain [56437] (15 proteins)

6. Protein Snake coagglutinin [56446] (4 species)

7. Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [64456] (1 PDB entry)

8. Domain d1ioda_: 1iod A: [62622]
   Other proteins in same PDB: d1iodg_

Details for d1ioda_

PDB Entry: 1iod, 2.3 Å

PDB Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x

SCOP Domain Sequences for d1ioda_:

Sequence; same for both SEQRES and ATOM records:

>d1ioda_ d.169.1.1 (A:) Snake coagglutinin {Sharp-nosed viper (Deinagkistrodon acutus)}
dcssgwssyeghcykvfkqsktwadaesfctkqvngghlvsiessgeadfvgqliaqkik
sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce
qqdpfvcea

Timeline for d1ioda_:

• d1ioda_ is new in SCOP 1.57
  
• d1ioda_ appears in SCOP 1.59
  
• d1ioda_ appears in the current release, SCOPe 2.08