SCOPe 2.08: Domain d1im9e2: 1im9 E:1-181

Lineage for d1im9e2 (1im9 E:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [54478] (2 PDB entries)

8. Domain d1im9e2: 1im9 E:1-181 [62588]
   Other proteins in same PDB: d1im9a1, d1im9b2, d1im9b3, d1im9d1, d1im9d2, d1im9e1, d1im9f2, d1im9f3

Details for d1im9e2

PDB Entry: 1im9, 2.8 Å

PDB Description: Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to its MHC ligand HLA-Cw4

PDB Compounds: (E:) hla class I histocompatibility antigen, cw-4 cw*0401 alpha chain

SCOPe Domain Sequences for d1im9e2:

Sequence; same for both SEQRES and ATOM records:

>d1im9e2 d.19.1.1 (E:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW4 [TaxId: 9606]}
gshsmryfstsvswpgrgeprfiavgyvddtqfvrfdsdaasprgeprepwveqegpeyw
dretqkykrqaqadrvnlrklrgyynqsedgshtlqrmfgcdlgpdgrllrgynqfaydg
kdyialnedlrswtaadtaaqitqrkweaareaeqrraylegtcvewlrrylengketlq
r

Timeline for d1im9e2:

• d1im9e2 first appeared in SCOP 1.57
  
• d1im9e2 appears in SCOPe 2.07