Lineage for d1ilfa_ (1ilf A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957198Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
    barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices
  4. 957199Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) (S)
  5. 957200Family b.54.1.1: Core binding factor beta, CBF [50724] (1 protein)
  6. 957201Protein Core binding factor beta, CBF [50725] (2 species)
  7. 957210Species Mouse (Mus musculus) [TaxId:10090] [50727] (3 PDB entries)
  8. 957213Domain d1ilfa_: 1ilf A: [62543]

Details for d1ilfa_

PDB Entry: 1ilf (more details)

PDB Description: nmr structure of apo cbfb
PDB Compounds: (A:) core-binding factor

SCOPe Domain Sequences for d1ilfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilfa_ b.54.1.1 (A:) Core binding factor beta, CBF {Mouse (Mus musculus) [TaxId: 10090]}
mprvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvat
gtnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrld
gmgclefdeeraqqedalaqq

SCOPe Domain Coordinates for d1ilfa_:

Click to download the PDB-style file with coordinates for d1ilfa_.
(The format of our PDB-style files is described here.)

Timeline for d1ilfa_: