SCOP 1.75: Domain d1ijeb_: 1ije B:

Lineage for d1ijeb_ (1ije B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.12: eEF-1beta-like [54984] (1 family)

5. Family d.58.12.1: eEF-1beta-like [54985] (2 proteins)

6. Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (6 PDB entries)

8. Domain d1ijeb_: 1ije B: [62488]
   Other proteins in same PDB: d1ijea1, d1ijea2, d1ijea3
   complexed with gdp

Details for d1ijeb_

PDB Entry: 1ije, 2.4 Å

PDB Description: nucleotide exchange intermediates in the eef1a-eef1ba complex

PDB Compounds: (B:) elongation factor 1-beta

SCOP Domain Sequences for d1ijeb_:

Sequence; same for both SEQRES and ATOM records:

>d1ijeb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqkl

Timeline for d1ijeb_:

• d1ijeb_ first appeared in SCOP 1.57
  
• d1ijeb_ appears in SCOP 1.73
  
• d1ijeb_ appears in SCOPe 2.01
  
• d1ijeb_ appears in the current release, SCOPe 2.08