Lineage for d1ijeb_ (1ije B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953608Superfamily d.58.12: eEF-1beta-like [54984] (1 family) (S)
    automatically mapped to Pfam PF00736
  5. 2953609Family d.58.12.1: eEF-1beta-like [54985] (3 proteins)
  6. 2953613Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)
  7. 2953614Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (7 PDB entries)
  8. 2953621Domain d1ijeb_: 1ije B: [62488]
    Other proteins in same PDB: d1ijea1, d1ijea2, d1ijea3
    complexed with gdp

Details for d1ijeb_

PDB Entry: 1ije (more details), 2.4 Å

PDB Description: nucleotide exchange intermediates in the eef1a-eef1ba complex
PDB Compounds: (B:) elongation factor 1-beta

SCOPe Domain Sequences for d1ijeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijeb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqkl

SCOPe Domain Coordinates for d1ijeb_:

Click to download the PDB-style file with coordinates for d1ijeb_.
(The format of our PDB-style files is described here.)

Timeline for d1ijeb_: