Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.3: C2 set domains [49142] (7 proteins) |
Protein Second domain of vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries) |
Domain d1ij9a1: 1ij9 A:91-196 [62482] Other proteins in same PDB: d1ij9a2 |
PDB Entry: 1ij9 (more details), 3 Å
SCOP Domain Sequences for d1ij9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ij9a1 b.1.1.3 (A:91-196) Second domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)} fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvy
Timeline for d1ij9a1: