Lineage for d1ij8b_ (1ij8 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805789Protein Avidin [50880] (1 species)
  7. 2805790Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries)
  8. 2805798Domain d1ij8b_: 1ij8 B: [62481]
    complexed with bni, nag

Details for d1ij8b_

PDB Entry: 1ij8 (more details), 2 Å

PDB Description: crystal structure of lite avidin-bni complex
PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d1ij8b_:

Sequence, based on SEQRES records: (download)

>d1ij8b_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rl

Sequence, based on observed residues (ATOM records): (download)

>d1ij8b_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtneikesplhgtentinkrtqptf
gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

SCOPe Domain Coordinates for d1ij8b_:

Click to download the PDB-style file with coordinates for d1ij8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ij8b_: