Lineage for d1ij8b_ (1ij8 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62326Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 62327Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 62328Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 62329Protein Avidin [50880] (1 species)
  7. 62330Species Chicken (Gallus gallus) [TaxId:9031] [50881] (6 PDB entries)
  8. 62332Domain d1ij8b_: 1ij8 B: [62481]

Details for d1ij8b_

PDB Entry: 1ij8 (more details), 2 Å

PDB Description: crystal structure of lite avidin-bni complex

SCOP Domain Sequences for d1ij8b_:

Sequence, based on SEQRES records: (download)

>d1ij8b_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rl

Sequence, based on observed residues (ATOM records): (download)

>d1ij8b_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtneikesplhgtentinkrtqptf
gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

SCOP Domain Coordinates for d1ij8b_:

Click to download the PDB-style file with coordinates for d1ij8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ij8b_: