| Class h: Coiled coil proteins [57942] (6 folds) |
| Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
| Family h.1.3.1: Leucine zipper domain [57960] (13 proteins) |
| Protein GCN4 [57961] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries) |
| Domain d1ij2b_: 1ij2 B: [62475] |
PDB Entry: 1ij2 (more details), 1.7 Å
SCOP Domain Sequences for d1ij2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ij2b_ h.1.3.1 (B:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveellsktyhlenevarlkklvge
Timeline for d1ij2b_: