Lineage for d1ij0a_ (1ij0 A:)

  1. Root: SCOP 1.59
  2. 145365Class h: Coiled coil proteins [57942] (5 folds)
  3. 145366Fold h.1: Parallel coiled-coil [57943] (21 superfamilies)
  4. 145470Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 145471Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. 145513Protein GCN4 [57961] (1 species)
  7. 145514Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (23 PDB entries)
  8. 145532Domain d1ij0a_: 1ij0 A: [62468]

Details for d1ij0a_

PDB Entry: 1ij0 (more details), 1.86 Å

PDB Description: coiled coil trimer gcn4-pvls ser at buried d position

SCOP Domain Sequences for d1ij0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ij0a_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae)}
rmkqledkveeslskvyhlenevarlkklvg

SCOP Domain Coordinates for d1ij0a_:

Click to download the PDB-style file with coordinates for d1ij0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ij0a_: