Lineage for d1iipa2 (1iip A:2-196)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113906Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 113907Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 113908Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 114013Protein Cyclophilin 40 isomerase domain [63814] (1 species)
  7. 114014Species Cow (Bos taurus) [TaxId:9913] [63815] (2 PDB entries)
  8. 114016Domain d1iipa2: 1iip A:2-196 [62452]
    Other proteins in same PDB: d1iipa1

Details for d1iipa2

PDB Entry: 1iip (more details), 2 Å

PDB Description: Bovine Cyclophilin 40, Tetragonal Form

SCOP Domain Sequences for d1iipa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iipa2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus)}
shpspqakpsnpsnprvffdvdiggervgrivlelfadivpktaenfralctgekgigpt
tgkplhfkgcpfhriikkfmiqggdfsnqngtggesiygekfedenfhykhdkegllsma
nagsntngsqffittvptphldgkhvvfgqvikgmgvakilenvevkgekpaklcviaec
gelkegddwgifpkd

SCOP Domain Coordinates for d1iipa2:

Click to download the PDB-style file with coordinates for d1iipa2.
(The format of our PDB-style files is described here.)

Timeline for d1iipa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iipa1