Lineage for d1iimb_ (1iim B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1614914Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1614915Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1615076Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 1615095Protein RmlA (RfbA) [53465] (5 species)
  7. 1615192Species Salmonella enterica [TaxId:28901] [64135] (5 PDB entries)
  8. 1615198Domain d1iimb_: 1iim B: [62446]
    complexed with ttp

Details for d1iimb_

PDB Entry: 1iim (more details), 2.1 Å

PDB Description: thymidylyltransferase complexed with TTP
PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d1iimb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iimb_ c.68.1.6 (B:) RmlA (RfbA) {Salmonella enterica [TaxId: 28901]}
mktrkgiilaggsgtrlypvtmavsqqllpiydkpmiyyplstlmlagirdiliistpqd
tprfqqllgdgsqwglnlqykvqpspdglaqafiigeefighddcalvlgdnifyghdlp
klmeaavnkesgatvfayhvndperygvvefdqkgtavsleekplqpksnyavtglyfyd
nsvvemaknlkpsargeleitdinriymeqgrlsvammgrgyawldtgthqslieasnfi
atieerqglkvscpeeiafrknfinaqqvielagplskndygkyllkmv

SCOPe Domain Coordinates for d1iimb_:

Click to download the PDB-style file with coordinates for d1iimb_.
(The format of our PDB-style files is described here.)

Timeline for d1iimb_: