Lineage for d1iida2 (1iid A:219-455)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037588Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 1037589Protein N-myristoyl transferase, NMT [55749] (3 species)
  7. 1037590Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55750] (3 PDB entries)
  8. 1037596Domain d1iida2: 1iid A:219-455 [62427]
    complex with s-(2-oxo)pentadecyl-CoA and the octapeptide
    complexed with nhm, ni

Details for d1iida2

PDB Entry: 1iid (more details), 2.5 Å

PDB Description: Crystal Structure of Saccharomyces cerevisiae N-myristoyltransferase with Bound S-(2-oxo)pentadecylCoA and the Octapeptide GLYASKLA
PDB Compounds: (A:) Peptide N-myristoyltransferase

SCOPe Domain Sequences for d1iida2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iida2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ythrplnwkklyevdftglpdghteedmiaenalpaktktaglrklkkedidqvfelfkr
yqsrfeliqiftkeefehnfigeeslpldkqvifsyvveqpdgkitdffsfyslpftiln
ntkykdlgigylyyyatdadfqfkdrfdpkatkalktrlceliydacilaknanmdvfna
ltsqdntlflddlkfgpgdgflnfylfnyrakpitgglnpdnsndikrrsnvgvvml

SCOPe Domain Coordinates for d1iida2:

Click to download the PDB-style file with coordinates for d1iida2.
(The format of our PDB-style files is described here.)

Timeline for d1iida2: