SCOP 1.65: Domain d1iida2: 1iid A:219-455

Lineage for d1iida2 (1iid A:219-455)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (4 families)

5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein N-myristoyl transferase, NMT [55749] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55750] (3 PDB entries)

8. Domain d1iida2: 1iid A:219-455 [62427]
   complex with s-(2-oxo)pentadecyl-CoA and the octapeptide
   complexed with nhm, ni

Details for d1iida2

PDB Entry: 1iid, 2.5 Å

PDB Description: Crystal Structure of Saccharomyces cerevisiae N-myristoyltransferase with Bound S-(2-oxo)pentadecylCoA and the Octapeptide GLYASKLA

SCOP Domain Sequences for d1iida2:

Sequence; same for both SEQRES and ATOM records:

>d1iida2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae)}
ythrplnwkklyevdftglpdghteedmiaenalpaktktaglrklkkedidqvfelfkr
yqsrfeliqiftkeefehnfigeeslpldkqvifsyvveqpdgkitdffsfyslpftiln
ntkykdlgigylyyyatdadfqfkdrfdpkatkalktrlceliydacilaknanmdvfna
ltsqdntlflddlkfgpgdgflnfylfnyrakpitgglnpdnsndikrrsnvgvvml

Timeline for d1iida2:

• d1iida2 first appeared in SCOP 1.57
  
• d1iida2 appears in SCOP 1.63
  
• d1iida2 appears in SCOP 1.67
  
• d1iida2 appears in the current release, SCOPe 2.08