Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) |
Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
Protein N-myristoyl transferase, NMT [55749] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55750] (3 PDB entries) |
Domain d1iida2: 1iid A:219-455 [62427] complex with s-(2-oxo)pentadecyl-CoA and the octapeptide complexed with nhm, ni |
PDB Entry: 1iid (more details), 2.5 Å
SCOP Domain Sequences for d1iida2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iida2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae)} ythrplnwkklyevdftglpdghteedmiaenalpaktktaglrklkkedidqvfelfkr yqsrfeliqiftkeefehnfigeeslpldkqvifsyvveqpdgkitdffsfyslpftiln ntkykdlgigylyyyatdadfqfkdrfdpkatkalktrlceliydacilaknanmdvfna ltsqdntlflddlkfgpgdgflnfylfnyrakpitgglnpdnsndikrrsnvgvvml
Timeline for d1iida2: