![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
![]() | Protein N-myristoyl transferase, NMT [55749] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55750] (3 PDB entries) |
![]() | Domain d1iicb1: 1iic B:34-218 [62424] complexed with mya |
PDB Entry: 1iic (more details), 2.2 Å
SCOPe Domain Sequences for d1iicb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iicb1 d.108.1.2 (B:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} amkdhkfwrtqpvkdfdekvveegpidkpktpedisdkplpllssfewcsidvdnkkqle dvfvllnenyvedrdagfrfnytkeffnwalkspgwkkdwhigvrvketqklvafisaip vtlgvrgkqvpsveinflcvhkqlrskrltpvlikeitrrvnkcdiwhalytagivlpap vstcr
Timeline for d1iicb1: