Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.103: MTH938-like [64075] (1 superfamily) core: 3 layers, b+a/b/a ; the central mixed sheet of 5 strands: order 21534; strand 2 is antiparallel to the rest |
Superfamily c.103.1: MTH938-like [64076] (1 family) |
Family c.103.1.1: MTH938-like [64077] (5 proteins) |
Protein Hypothetical protein MT938 (MTH938) [64078] (1 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [64079] (1 PDB entry) |
Domain d1ihna_: 1ihn A: [62388] complexed with cl |
PDB Entry: 1ihn (more details), 2.2 Å
SCOPe Domain Sequences for d1ihna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihna_ c.103.1.1 (A:) Hypothetical protein MT938 (MTH938) {Methanobacterium thermoautotrophicum [TaxId: 145262]} shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc
Timeline for d1ihna_: