SCOP 1.75: Domain d1ihmc_: 1ihm C:

Lineage for d1ihmc_ (1ihm C:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families)

5. Family b.121.4.3: Caliciviridae-like VP [88637] (1 protein)

6. Protein Calicivirus capsid protein [63691] (1 species)
   includes the P (protruding) domain of complex beta-structure containing a beta-barrel similar to the second domain of EF-TU

7. Species Norwalk virus [TaxId:11983] [63692] (1 PDB entry)

8. Domain d1ihmc_: 1ihm C: [62387]

Details for d1ihmc_

PDB Entry: 1ihm, 3.4 Å

PDB Description: crystal structure analysis of norwalk virus capsid

PDB Compounds: (C:) capsid protein

SCOP Domain Sequences for d1ihmc_:

Sequence; same for both SEQRES and ATOM records:

>d1ihmc_ b.121.4.3 (C:) Calicivirus capsid protein {Norwalk virus [TaxId: 11983]}
dplamdpvagsstavatagqvnpidpwiinnfvqapqgeftispnntpgdvlfdlslgph
lnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscippgfgshnltiaqatlfphv
iadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytplrtgggtgdsfvvagrvmt
cpspdfnflflvpptveqktrpftlpnlplsslsnsraplpissmgispdnvqsvqfqng
rctldgrlvgttpvslshvakirgtsngtvinlteldgtpfhpfegpapigfpdlggcdw
hinmtqfghssqtqydvdttpdtfvphlgsiqangigsgnyvgvlswisppshpsgsqvd
lwkipnygssiteathlapsvyppgfgevlvffmskmpgpgaynlpcllpqeyishlase
qaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngassgpqqlpingvfvfvswvs
rfyqlkpvgtas

Timeline for d1ihmc_:

• d1ihmc_ first appeared in SCOP 1.57
  
• d1ihmc_ appears in SCOP 1.73
  
• d1ihmc_ appears in SCOPe 2.01
  
• d1ihmc_ appears in the current release, SCOPe 2.08