Lineage for d1ihmc_ (1ihm C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 56533Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 56534Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 56646Family b.10.1.4: Animal virus proteins [49656] (16 proteins)
  6. 56652Protein Calcivirus capsid protein [63691] (1 species)
  7. 56653Species Norwalk virus [TaxId:11983] [63692] (1 PDB entry)
  8. 56656Domain d1ihmc_: 1ihm C: [62387]

Details for d1ihmc_

PDB Entry: 1ihm (more details), 3.4 Å

PDB Description: crystal structure analysis of norwalk virus capsid

SCOP Domain Sequences for d1ihmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihmc_ b.10.1.4 (C:) Calcivirus capsid protein {Norwalk virus}
dplamdpvagsstavatagqvnpidpwiinnfvqapqgeftispnntpgdvlfdlslgph
lnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscippgfgshnltiaqatlfphv
iadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytplrtgggtgdsfvvagrvmt
cpspdfnflflvpptveqktrpftlpnlplsslsnsraplpissmgispdnvqsvqfqng
rctldgrlvgttpvslshvakirgtsngtvinlteldgtpfhpfegpapigfpdlggcdw
hinmtqfghssqtqydvdttpdtfvphlgsiqangigsgnyvgvlswisppshpsgsqvd
lwkipnygssiteathlapsvyppgfgevlvffmskmpgpgaynlpcllpqeyishlase
qaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngassgpqqlpingvfvfvswvs
rfyqlkpvgtas

SCOP Domain Coordinates for d1ihmc_:

Click to download the PDB-style file with coordinates for d1ihmc_.
(The format of our PDB-style files is described here.)

Timeline for d1ihmc_: