Lineage for d1ihga1 (1ihg A:197-365)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.8: Tetratricopeptide repeat (TPR) [48452] (1 family) 
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (6 proteins)
this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
Protein Cyclophilin 40 [63618] (1 species) Species Cow (Bos taurus) [TaxId:9913] [63619] (2 PDB entries) 
Domain d1ihga1: 1ihg A:197-365 [62380]
Other proteins in same PDB: d1ihga2
Details for d1ihga1
PDB Entry: 1ihg (more details), 1.8 Å
PDB Description: Bovine Cyclophilin 40, monoclinic form
SCOP Domain Sequences for d1ihga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus)}
gsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwemaikkytkvlryvegs
raaaedadgaklqpvalscvlnigacklkmsdwqgavdsclealeidpsntkalyrraqg
wqglkeydqaladlkkaqeiapedkaiqaellkvkqkikaqkdkekaay
SCOP Domain Coordinates for d1ihga1:
Click to download the PDB-style file with coordinates for d1ihga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ihga1:
- d1ihga1 is new in SCOP 1.57
- d1ihga1 appears in SCOP 1.59
- d1ihga1 appears in the current release, SCOPe 2.08
View in 3D
