![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Cyclophilin 40 [63618] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [63619] (2 PDB entries) |
![]() | Domain d1ihga1: 1ihg A:197-365 [62380] Other proteins in same PDB: d1ihga2 complexed with gol |
PDB Entry: 1ihg (more details), 1.8 Å
SCOPe Domain Sequences for d1ihga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} gsgdshpdfpedadvdlkdvdkillisedlknigntffksqnwemaikkytkvlryvegs raaaedadgaklqpvalscvlnigacklkmsdwqgavdsclealeidpsntkalyrraqg wqglkeydqaladlkkaqeiapedkaiqaellkvkqkikaqkdkekaay
Timeline for d1ihga1: