![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.1: MogA-like [53219] (6 proteins) |
![]() | Protein Gephyrin N-terminal domain [64100] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [64101] (1 PDB entry) |
![]() | Domain d1ihca_: 1ihc A: [62379] |
PDB Entry: 1ihc (more details), 1.9 Å
SCOPe Domain Sequences for d1ihca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihca_ c.57.1.1 (A:) Gephyrin N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd
Timeline for d1ihca_: