Lineage for d1ihca_ (1ihc A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72494Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
  4. 72495Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 72496Family c.57.1.1: MogA-like [53219] (2 proteins)
  6. 72497Protein Gephyrin N-terminal domain [64100] (2 species)
  7. 72502Species Rat (Rattus norvegicus) [TaxId:10116] [64101] (1 PDB entry)
  8. 72503Domain d1ihca_: 1ihc A: [62379]

Details for d1ihca_

PDB Entry: 1ihc (more details), 1.9 Å

PDB Description: X-ray Structure of Gephyrin N-terminal Domain

SCOP Domain Sequences for d1ihca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihca_ c.57.1.1 (A:) Gephyrin N-terminal domain {Rat (Rattus norvegicus)}
hqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivpdeieeiketlid
wcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgslnvtplgmlsrpv
cgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevhd

SCOP Domain Coordinates for d1ihca_:

Click to download the PDB-style file with coordinates for d1ihca_.
(The format of our PDB-style files is described here.)

Timeline for d1ihca_: