Lineage for d1igwc_ (1igw C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1574300Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1574480Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 1574504Protein Isocitrate lyase [51642] (3 species)
    elaborated with additional subdomains
  7. 1574507Species Escherichia coli [TaxId:562] [63923] (1 PDB entry)
  8. 1574510Domain d1igwc_: 1igw C: [62372]
    complexed with hg, mg, pyr; mutant

Details for d1igwc_

PDB Entry: 1igw (more details), 2.1 Å

PDB Description: crystal structure of the isocitrate lyase from the a219c mutant of escherichia coli
PDB Compounds: (C:) isocitrate lyase

SCOPe Domain Sequences for d1igwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igwc_ c.1.12.7 (C:) Isocitrate lyase {Escherichia coli [TaxId: 562]}
ktrtqqieelqkewtqprwegitrpysaedvvklrgsvnpectlaqlgaakmwrllhges
kkgyinslgaltggqalqqakagieavylsgwqvaadanlaasmypdqslypansvpavv
erinntfrradqiqwsagiepgdpryvdyflpivadaeagfggvlnafelmkamieagaa
avhfedqlasvkkcghmggkvlvptqeaiqklvaarlcadvtgvptllvartdadaadli
tsdcdpydsefitgertsegffrthagieqaisrglayapyadlvwcetstpdlelarrf
aqaihakypgkllayncspsfnwqknlddktiasfqqqlsdmgykfqfitlagihsmwfn
mfdlanayaqgegmkhyvekvqqpefaaakdgytfvshqqevgtgyfdkvttiiqg

SCOPe Domain Coordinates for d1igwc_:

Click to download the PDB-style file with coordinates for d1igwc_.
(The format of our PDB-style files is described here.)

Timeline for d1igwc_: