SCOP 1.65: Domain d1ie7b_: 1ie7 B:

Lineage for d1ie7b_ (1ie7 B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)

6. Protein Urease, beta-subunit [51280] (3 species)

7. Species Bacillus pasteurii [TaxId:1474] [51282] (5 PDB entries)

8. Domain d1ie7b_: 1ie7 B: [62314]
   Other proteins in same PDB: d1ie7a_, d1ie7c1, d1ie7c2
   complexed with ni, po4

Details for d1ie7b_

PDB Entry: 1ie7, 1.85 Å

PDB Description: phosphate inhibited bacillus pasteurii urease crystal structure

SCOP Domain Sequences for d1ie7b_:

Sequence; same for both SEQRES and ATOM records:

>d1ie7b_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

Timeline for d1ie7b_:

• d1ie7b_ first appeared in SCOP 1.57
  
• d1ie7b_ appears in SCOP 1.63
  
• d1ie7b_ appears in SCOP 1.67
  
• d1ie7b_ appears in the current release, SCOPe 2.08