SCOP 1.65: Domain d1ie7a_: 1ie7 A:

Lineage for d1ie7a_ (1ie7 A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (1 family)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (1 protein)

6. Protein Urease, gamma-subunit [54113] (3 species)

7. Species Bacillus pasteurii [TaxId:1474] [54115] (5 PDB entries)

8. Domain d1ie7a_: 1ie7 A: [62313]
   Other proteins in same PDB: d1ie7b_, d1ie7c1, d1ie7c2
   complexed with ni, po4

Details for d1ie7a_

PDB Entry: 1ie7, 1.85 Å

PDB Description: phosphate inhibited bacillus pasteurii urease crystal structure

SCOP Domain Sequences for d1ie7a_:

Sequence; same for both SEQRES and ATOM records:

>d1ie7a_ d.8.1.1 (A:) Urease, gamma-subunit {Bacillus pasteurii}
mhlnpaekeklqiflaselllrrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

Timeline for d1ie7a_:

• d1ie7a_ first appeared in SCOP 1.57
  
• d1ie7a_ appears in SCOP 1.63
  
• d1ie7a_ appears in SCOP 1.67
  
• d1ie7a_ appears in the current release, SCOPe 2.08