Lineage for d1ie5a_ (1ie5 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1109354Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1109642Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)
  7. 1109643Species Chicken (Gallus gallus) [TaxId:9031] [63664] (1 PDB entry)
  8. 1109644Domain d1ie5a_: 1ie5 A: [62312]
    module 3

Details for d1ie5a_

PDB Entry: 1ie5 (more details)

PDB Description: nmr structure of the third immunoglobulin domain from the neural cell adhesion molecule.
PDB Compounds: (A:) neural cell adhesion molecule

SCOPe Domain Sequences for d1ie5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie5a_ b.1.1.4 (A:) Neural cell adhesion molecule (NCAM) {Chicken (Gallus gallus) [TaxId: 9031]}
gkdiqvivnvppsvrarqstmnatanlsqsvtlacdadgfpeptmtwtkdgepieqedne
ekysfnydgseliikkvdksdeaeyiciaenkageqdatihlkvfak

SCOPe Domain Coordinates for d1ie5a_:

Click to download the PDB-style file with coordinates for d1ie5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ie5a_: