SCOP 1.73: Domain d1ie3b1: 1ie3 B:1-145

Lineage for d1ie3b1 (1ie3 B:1-145)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)
Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
Protein Malate dehydrogenase [51849] (12 species)
Species Escherichia coli [TaxId:562] [51853] (5 PDB entries)
Domain d1ie3b1: 1ie3 B:1-145 [62306]
Other proteins in same PDB: d1ie3a2, d1ie3b2, d1ie3c2, d1ie3d2

Details for d1ie3b1

PDB Entry: 1ie3 (more details), 2.5 Å

PDB Description: crystal structure of r153c e. coli malate dehydrogenase

PDB Compounds: (B:) malate dehydrogenase

SCOP Domain Sequences for d1ie3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie3b1 c.2.1.5 (B:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

SCOP Domain Coordinates for d1ie3b1:

Click to download the PDB-style file with coordinates for d1ie3b1.
(The format of our PDB-style files is described here.)

Timeline for d1ie3b1: