Lineage for d1idha_ (1idh A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032155Protein Bungarotoxin [57324] (4 species)
  7. 3032156Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries)
  8. 3032181Domain d1idha_: 1idh A: [62297]
    complexed to an 18mer cognate peptide

Details for d1idha_

PDB Entry: 1idh (more details)

PDB Description: the nmr solution structure of the complex formed between alpha- bungarotoxin and an 18mer cognate peptide
PDB Compounds: (A:) alpha-bungarotoxin

SCOPe Domain Sequences for d1idha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idha_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOPe Domain Coordinates for d1idha_:

Click to download the PDB-style file with coordinates for d1idha_.
(The format of our PDB-style files is described here.)

Timeline for d1idha_: