Lineage for d1id5.1 (1id5 L:,H:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins) 
Protein Thrombin [50531] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries) 
Domain d1id5.1: 1id5 L:,H: [62293]
Other proteins in same PDB: d1id5i_
Details for d1id5.1
PDB Entry: 1id5 (more details), 2.5 Å
PDB Description: crystal structure of bovine thrombin complex with protease inhibitor ecotin
SCOP Domain Sequences for d1id5.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1id5.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
geadcglrplfekkqvqdqtekelfesyieXivegqdaevglspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpr
ynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwt
tsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpf
vmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidr
SCOP Domain Coordinates for d1id5.1:
Click to download the PDB-style file with coordinates for d1id5.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1id5.1:
- d1id5.1 first appeared in SCOP 1.57
- d1id5.1 appears in SCOP 1.61
- d1id5.1 appears in the current release, SCOPe 2.08
View in 3D
