Lineage for d1ibmf_ (1ibm F:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1070170Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1070227Domain d1ibmf_: 1ibm F: [62211]
    protein/RNA complex; complexed with mg, zn

Details for d1ibmf_

PDB Entry: 1ibm (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1ibmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibmf_ i.1.1.1 (F:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1ibmf_:

Click to download the PDB-style file with coordinates for d1ibmf_.
(The format of our PDB-style files is described here.)

Timeline for d1ibmf_: