SCOP 1.63: Domain d1ibkh_: 1ibk H:

Lineage for d1ibkh_ (1ibk H:)

1. Root: SCOP 1.63

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)

8. Domain d1ibkh_: 1ibk H: [62171]

Details for d1ibkh_

PDB Entry: 1ibk, 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin

SCOP Domain Sequences for d1ibkh_:

Sequence; same for both SEQRES and ATOM records:

>d1ibkh_ i.1.1.1 (H:) 70S ribosome functional complex {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

Timeline for d1ibkh_:

• d1ibkh_ first appeared in SCOP 1.57
  
• d1ibkh_ appears in SCOP 1.61
  
• d1ibkh_ appears in SCOP 1.65
  
• d1ibkh_ appears in the current release, SCOPe 2.08