Lineage for d1ib6b2 (1ib6 B:146-312)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138998Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 138999Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 139000Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 139061Protein Malate dehydrogenase [56329] (10 species)
  7. 139088Species Escherichia coli [TaxId:562] [56333] (4 PDB entries)
  8. 139092Domain d1ib6b2: 1ib6 B:146-312 [62149]
    Other proteins in same PDB: d1ib6a1, d1ib6b1, d1ib6c1, d1ib6d1

Details for d1ib6b2

PDB Entry: 1ib6 (more details), 2.1 Å

PDB Description: crystal structure of r153c e. coli malate dehydrogenase

SCOP Domain Sequences for d1ib6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib6b2 d.162.1.1 (B:146-312) Malate dehydrogenase {Escherichia coli}
vttldiicsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgqefvnk

SCOP Domain Coordinates for d1ib6b2:

Click to download the PDB-style file with coordinates for d1ib6b2.
(The format of our PDB-style files is described here.)

Timeline for d1ib6b2: