Lineage for d1ia8a_ (1ia8 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542825Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
    CaMK group; CAMKL subfamily; serine/threonine kinase
  7. 2542826Species Human (Homo sapiens) [TaxId:9606] [64405] (85 PDB entries)
  8. 2542839Domain d1ia8a_: 1ia8 A: [62112]
    complexed with so4

Details for d1ia8a_

PDB Entry: 1ia8 (more details), 1.7 Å

PDB Description: the 1.7 a crystal structure of human cell cycle checkpoint kinase chk1
PDB Compounds: (A:) chk1 checkpoint kinase

SCOPe Domain Sequences for d1ia8a_:

Sequence, based on SEQRES records: (download)

>d1ia8a_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplkkgakrp

Sequence, based on observed residues (ATOM records): (download)

>d1ia8a_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrcpenikkeicinkmlnh
envvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgi
githrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrref
haepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhk
ilvenpsaritipdikkdrwynkplkkgakrp

SCOPe Domain Coordinates for d1ia8a_:

Click to download the PDB-style file with coordinates for d1ia8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ia8a_: