![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension automatically mapped to Pfam PF00416 |
![]() | Protein Ribosomal protein S13 [46948] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries) Uniprot P80377 |
![]() | Domain d1i97m_: 1i97 M: [62071] Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_ complexed with mg, tac, wo2, zn |
PDB Entry: 1i97 (more details), 4.5 Å
SCOPe Domain Sequences for d1i97m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i97m_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrr
Timeline for d1i97m_: