Class a: All alpha proteins [46456] (226 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Cytochrome c2 [46650] (8 species) |
Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries) |
Domain d1i8oa_: 1i8o A: [61979] complexed with hec, nh3, sul |
PDB Entry: 1i8o (more details), 1.15 Å
SCOP Domain Sequences for d1i8oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8oa_ a.3.1.1 (A:) Cytochrome c2 {Rhodopseudomonas palustris} edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk
Timeline for d1i8oa_: