Lineage for d1i8fe_ (1i8f E:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166075Fold b.38: Sm-like fold [50181] (2 superfamilies)
  4. 166076Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families) (S)
  5. 166077Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 166078Protein Archaeal homoheptameric Sm protein [63758] (4 species)
  7. 166146Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [63760] (1 PDB entry)
  8. 166151Domain d1i8fe_: 1i8f E: [61963]

Details for d1i8fe_

PDB Entry: 1i8f (more details), 1.75 Å

PDB Description: the crystal structure of a heptameric archaeal sm protein: implications for the eukaryotic snrnp core

SCOP Domain Sequences for d1i8fe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8fe_ b.38.1.1 (E:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum}
tlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmvvrg
envlfispvp

SCOP Domain Coordinates for d1i8fe_:

Click to download the PDB-style file with coordinates for d1i8fe_.
(The format of our PDB-style files is described here.)

Timeline for d1i8fe_: